Www.youtor.org Youtor


Search Videos By URL

Adai Dosai (updated 2024-12-16)

Adai onion vengaayam dosai preparation shorts shortsfeed [upl. by Radferd]
Duration: 0:11
253 views | 2 weeks ago
Adai Dosai food explorethebeautyofnature [upl. by Atiker]
Duration: 0:55
176 views | 1 month ago
Adai or dosai Its dinner time [upl. by Ringe827]
Duration: 0:21
421 views | 3 weeks ago
Surakkaai adai dosai use asfotadida for this recipe [upl. by Dian493]
Duration: 1:01
577 views | 3 weeks ago
Chettinad Adai DosaiKaara Adai Recipe in Tamil32 [upl. by Wichman]
Duration: 4:07
230.6K views | 28 Jun 2020
Adai dosai illuminati [upl. by Derron]
Duration: 0:24
559 views | 2 months ago
Adai Dosa Recipe in Tamil How to make Adai Dosa in Tamil [upl. by Stranger]
Duration: 3:11
308 views | 1 month ago
Adai Dosai [upl. by Mac]
Duration: 0:16
410 views | 3 months ago
Yen Style Adai dosai ampkollu chatney shotsfoodviral [upl. by Tnelc910]
Duration: 0:40
163 views | 2 weeks ago
Breakfast Adai Dosai🥰 [upl. by Melamie396]
Duration: 0:45
418 views | 1 month ago
Adai Dosai [upl. by Lemhar]
Duration: 0:38
132 views | 1 month ago
sorakkai adai dosai trending video viralvideo [upl. by Imiaj]
Duration: 4:32
630 views | 3 weeks ago
Adai dosai High protein Dosa shorts how to make adai dosa [upl. by Richardson]
Duration: 0:55
544 views | 3 months ago
Adai Dosai 👌🤤Adai Recipe protein rich dosa recipe [upl. by Klecka]
Duration: 4:56
415 views | 2 months ago
Adai dosaibreakfastrecipeadairecipehealthsimpletasty [upl. by Teeniv347]
Duration: 0:53
104 views | 2 weeks ago
Adai dosai coconut chutney Maniyachi maindhan Ajith😎 [upl. by Heigho362]
Duration: 0:14
5.9M views | 16 Jun 2022
Todays special Adai dosai [upl. by Nydia]
Duration: 0:14
|



New on site
Content Report
youtor.org / Youtor Videos converter © 2024